Talk:Protein secondary structure

(Redirected from Talk:Secondary structure)
Latest comment: 8 years ago by 2001:DA8:B005:7070:74FC:AADD:E7D4:46BF in topic MDAP-2

Too complex

edit

Introduction too detailed for the layman to understandsdfghjkl the basic concept of secondary structure of proteins. Contains too much information that could be elaborated upon further in the body.


—Preceding unsigned comment added by 66.253.133.106 (talk) 02:43, 24 March 2008 (UTC)Reply

Examples of secondary structures

edit

Deleted this as example of secondary structure:

such as the DNA "double helix."

since this seems like an example of quaternary structure, since it's 2 molecules. Anyway, RNA secondary structure is much more prominent.

Zashaw 04:34, 18 Feb 2004 (UTC)

Prediction

edit

I wanted to discuss this sentence:

While the prediction of protein secondary strcture is relativly straightforward, predicting RNA secondary structure is much harder.

I didn't think that protein secondary structure prediction was so easy (very likely just due to ignorance). Could someone name a program or citation or something that shows how this is easy? Thanks.

Zashaw 22:16, 18 Feb 2004 (UTC)

Amino acid propensities

edit

Want to add a section about amino acid propensities in secondary structure! --Dan|(talk) 18:10, 9 March 2006 (UTC)Reply

Aren't beta sheets tertiary structure?

edit

Is it not the case that beta strands are secondary structure but the beta sheets they form are tertiary structure?

Many textbooks do not recognise this, but this article should, assuming it's true.

Ben (talk) 14:56, 7 March 2009 (UTC)Reply

List of secondary structures?

edit

I was just popping in here to look up something basic (the claim that there are secondary structures other than alpha helix and beta sheets), and was a bit disappointed to notice that there wasn't a simple list of secondary structures. It should be fairly simple to add, and would add utility to the page. Mokele (talk) 13:48, 22 May 2009 (UTC)Reply

Beta strand vs. Beta sheet

edit

I endorse Ben's view about using beta strand (and not beta sheet) to exemplify the most common elements of secondary structure. Using beta sheets would be against the article's own definition of secondary structure ("the general three-dimensional form of local segments of biopolymers"). Beta sheets can are formed by different segments of proteins which can be very distant in the sequence, therefore it is tertiary structure, not secondary structure. While I understand why this confusion happens (one could not expect a single strand to exist by itself), it is important to make this distinction, because otherwise the definition and the example would be in conflict. — Preceding unsigned comment added by 150.164.24.242 (talk) 12:22, 9 September 2014 (UTC)Reply

MAPD-2

edit

MKFFTLLAALMALFAICNNFSMVSASRDSRPVQPRVQPPPPPPKQKPSIYDTPIRRPGGQKTMYA — Preceding unsigned comment added by 2001:DA8:B005:7070:74FC:AADD:E7D4:46BF (talk) 02:14, 18 September 2015 (UTC)Reply

MDAP-2

edit

MKFFTLLAALMALFAICNNFSMVSASRDSRPVQPRVQPPPPPPKQKPSIYDTPIRRPGGQKTMYA — Preceding unsigned comment added by 2001:DA8:B005:7070:74FC:AADD:E7D4:46BF (talk) 02:15, 18 September 2015 (UTC)Reply